PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 479087
Common NameARALYDRAFT_479087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 388aa    MW: 41584.2 Da    PI: 8.6023
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
479087genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r   + Rt+ q+ s+ qky
           479087 133 PWTEEEHRLFLVGLQKLGKGDWRGISRNYVTSRTPTQVASHAQKY 177
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.581126182IPR017930Myb domain
SuperFamilySSF466898.22E-17128182IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-18129180IPR006447Myb domain, plants
SMARTSM007171.7E-10130180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-11132176IPR009057Homeodomain-like
CDDcd001673.34E-9133178No hitNo description
PfamPF002494.8E-11133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPT RGGGTCGGSG GGGGGSCSSS TVKLFGVRLT DGSIIKKSAS  60
MGNLSALAVA AAAATHHRLS PSSPLATSNL NDSPLSDHAR YSNLHHNEGY LSDDPAHGSG  120
SSHRRGERKR GVPWTEEEHR LFLVGLQKLG KGDWRGISRN YVTSRTPTQV ASHAQKYFIR  180
HTSSSRRKRR SSLFDMVTDE MVTDSSPTED QSHQTLNRFS PSKEPENKIY LPSLELSLNN  240
TTESEVVVAT APPQEKTEET IEPSNGVSPM VVPGGFFPPC FPITYTIWLP ATSTSLHGTE  300
HALEAETSSQ QHQVLKPKPG FAKERVNMDE LVGMSQLSIG MATRHESETS PSPLSLKLEP  360
SRPSAFHSNG SVTGADLSKG NSAIQAI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0058320.0BT005832.1 Arabidopsis thaliana At3g16350 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002883001.10.0hypothetical protein ARALYDRAFT_479087
TrEMBLD7L5N90.0D7L5N9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__1788__AT3G16350.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM93132735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.10.0MYB_related family protein